NDUFB7 (NM_004146) Human Mass Spec Standard
CAT#: PH300784
NDUFB7 MS Standard C13 and N15-labeled recombinant protein (NP_004137)
View other "NDUFB7" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | NDUFB7 MS Standard C13 and N15-labeled recombinant protein (NP_004137) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200784 |
Predicted MW | 16.4 kDa |
Protein Sequence |
>RC200784 protein sequence
Red=Cloning site Green=Tags(s) MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCK RDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004137 |
RefSeq Size | 573 |
RefSeq ORF | 411 |
Synonyms | B18; CI-B18 |
Locus ID | 4713 |
Cytogenetics | 19p13.12 |
Summary | The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418189 | NDUFB7 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY418189 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa (NDUFB7), nuclear gene encoding mitochondrial protein |
CN¥ 3,080.00 |
|
TP300784 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa (NDUFB7), nuclear gene encoding mitochondrial protein, 20 µg |
CN¥ 2,900.00 |