EIF5A (NM_001970) Human Mass Spec Standard
CAT#: PH300770
EIF5A MS Standard C13 and N15-labeled recombinant protein (NP_001961)
View other "EIF5A" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | EIF5A MS Standard C13 and N15-labeled recombinant protein (NP_001961) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200770 |
Predicted MW | 16.8 kDa |
Protein Sequence |
>RC200770 protein sequence
Red=Cloning site Green=Tags(s) MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE DICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSA MTEEAAVAIKAMAK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001961 |
RefSeq Size | 1355 |
RefSeq ORF | 462 |
Synonyms | eIF-4D; EIF-5A; EIF5A1; eIF5AI |
Locus ID | 1984 |
Cytogenetics | 17p13.1 |
Summary | mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419616 | EIF5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428326 | EIF5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428327 | EIF5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419616 | Transient overexpression lysate of eukaryotic translation initiation factor 5A (EIF5A), transcript variant B |
CNY 3,080.00 |
|
LY428326 | Transient overexpression lysate of eukaryotic translation initiation factor 5A (EIF5A), transcript variant C |
CNY 3,080.00 |
|
LY428327 | Transient overexpression lysate of eukaryotic translation initiation factor 5A (EIF5A), transcript variant D |
CNY 3,080.00 |
|
PH326600 | EIF5A MS Standard C13 and N15-labeled recombinant protein (NP_001137233) |
CNY 19,520.00 |
|
PH326664 | EIF5A MS Standard C13 and N15-labeled recombinant protein (NP_001137234) |
CNY 19,520.00 |
|
TP300770 | Recombinant protein of human eukaryotic translation initiation factor 5A (EIF5A), transcript variant B, 20 µg |
CNY 2,900.00 |
|
TP326600 | Recombinant protein of human eukaryotic translation initiation factor 5A (EIF5A), transcript variant C, 20 µg |
CNY 2,900.00 |
|
TP326664 | Recombinant protein of human eukaryotic translation initiation factor 5A (EIF5A), transcript variant D, 20 µg |
CNY 2,900.00 |