S100A11 (NM_005620) Human Mass Spec Standard
CAT#: PH300656
S100A11 MS Standard C13 and N15-labeled recombinant protein (NP_005611)
View other "S100A11" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | S100A11 MS Standard C13 and N15-labeled recombinant protein (NP_005611) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200656 |
Predicted MW | 11.7 kDa |
Protein Sequence |
>RC200656 protein sequence
Red=Cloning site Green=Tags(s) MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTN SDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005611 |
RefSeq Size | 595 |
RefSeq ORF | 315 |
Synonyms | HEL-S-43; MLN70; S100C |
Locus ID | 6282 |
Cytogenetics | 1q21.3 |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417184 | S100A11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417184 | Transient overexpression lysate of S100 calcium binding protein A11 (S100A11) |
CNY 3,080.00 |
|
TP300656 | Recombinant protein of human S100 calcium binding protein A11 (S100A11), 20 µg |
CNY 2,900.00 |
其它S100A11产品