United States
Germany
Japan
United Kingdom
China
PAX8 (NM_003466) Human Mass Spec Standard
CAT＃: PH300651
PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_003457)
View other "PAX8" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_003457) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200651 |
| Predicted MW | 48.2 kDa |
| Protein Sequence |
>RC200651 protein sequence
Red=Cloning site Green=Tags(s) MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSI DSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTP SNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAAS VYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP NSSLLSSPYYYSSTSRPSAPPTTATAFDHL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003457 |
| RefSeq Size | 4065 |
| RefSeq ORF | 1350 |
| Locus ID | 7849 |
| Cytogenetics | 2q14.1 |
| Summary | This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Pathways in cancer, Thyroid cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401173 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415550 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415551 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415574 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429402 | PAX8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401173 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8A |
CNY 3,080.00 |
|
| LY415550 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8C |
CNY 3,080.00 |
|
| LY415551 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8D |
CNY 3,080.00 |
|
| LY415574 | Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8E |
CNY 3,080.00 |
|
| PH314188 | PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_039247) |
CNY 14,250.00 |
|
| PH315690 | PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_054698) |
CNY 14,250.00 |
|
| TP300651 | Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8A, 20 µg |
CNY 2,900.00 |
|
| TP314188 | Purified recombinant protein of Homo sapiens paired box 8 (PAX8), transcript variant PAX8D, 20 µg |
CNY 2,900.00 |
|
| TP315690 | Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8E, 20 µg |
CNY 2,900.00 |
|
| TP762414 | Purified recombinant protein of Human paired box 8 (PAX8), transcript variant PAX8A, Cys238-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
