United States
Germany
Japan
United Kingdom
China
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_001031806) Human Mass Spec Standard
CAT＃: PH300648
ALDH3A2 MS Standard C13 and N15-labeled recombinant protein (NP_001026976)
View other "Aldehyde dehydrogenase 10" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | ALDH3A2 MS Standard C13 and N15-labeled recombinant protein (NP_001026976) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200648 |
| Predicted MW | 57.7 kDa |
| Protein Sequence |
>RC200648 protein sequence
Red=Cloning site Green=Tags(s) MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDF MLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELS ENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGG KSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYE RIINLRHFKRILSLLEGQKIAFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAIN FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLVKKYQAVLRRK ALLIFLVVHRLRWSSKQR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001026976 |
| RefSeq Size | 3823 |
| RefSeq ORF | 1524 |
| Synonyms | ALDH10; FALDH; SLS |
| Locus ID | 224 |
| Cytogenetics | 17p11.2 |
| Summary | Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Arginine and proline metabolism, Ascorbate and aldarate metabolism, beta-Alanine metabolism, Butanoate metabolism, Fatty acid metabolism, Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Histidine metabolism, Limonene and pinene degradation, Lysine degradation, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism, Tryptophan metabolism, Valine, leucine and isoleucine degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422196 | ALDH3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424751 | ALDH3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424995 | ALDH3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422196 | Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1 |
CNY 3,080.00 |
|
| LY424751 | Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2 |
CNY 4,840.00 |
|
| LY424995 | Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2 |
CNY 3,080.00 |
|
| PH323398 | ALDH3A2 MS Standard C13 and N15-labeled recombinant protein (NP_000373) |
CNY 19,520.00 |
|
| TP300648 | Recombinant protein of human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP323398 | Recombinant protein of human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Aldehyde dehydrogenase 10产品
