DUSP4 (NM_001394) Human Mass Spec Standard
CAT#: PH300640
DUSP4 MS Standard C13 and N15-labeled recombinant protein (NP_001385)
View other "DUSP4" proteins (7)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | DUSP4 MS Standard C13 and N15-labeled recombinant protein (NP_001385) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200640 |
Predicted MW | 43 kDa |
Protein Sequence |
>RC200640 protein sequence
Red=Cloning site Green=Tags(s) MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGYILGSVNVRCN TIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDI CLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYH AARRDMLDALGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHC QAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPL RERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001385 |
RefSeq Size | 5625 |
RefSeq ORF | 1182 |
Synonyms | HVH2; MKP-2; MKP2; TYP |
Locus ID | 1846 |
Cytogenetics | 8p12 |
Summary | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus. Two alternatively spliced transcript variants, encoding distinct isoforms, have been observed for this gene. In addition, multiple polyadenylation sites have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Phosphatase |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400543 | DUSP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC403296 | DUSP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400543 | Transient overexpression lysate of dual specificity phosphatase 4 (DUSP4), transcript variant 1 |
CN¥ 3,080.00 |
|
LY403296 | Transient overexpression lysate of dual specificity phosphatase 4 (DUSP4), transcript variant 2 |
CN¥ 3,080.00 |
|
PH315252 | DUSP4 MS Standard C13 and N15-labeled recombinant protein (NP_476499) |
CN¥ 19,520.00 |
|
TP300640 | Recombinant protein of human dual specificity phosphatase 4 (DUSP4), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP315252 | Recombinant protein of human dual specificity phosphatase 4 (DUSP4), transcript variant 2, 20 µg |
CN¥ 2,900.00 |