BAD (NM_004322) Human Mass Spec Standard
CAT#: PH300634
BAD MS Standard C13 and N15-labeled recombinant protein (NP_004313)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | BAD MS Standard C13 and N15-labeled recombinant protein (NP_004313) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200634 |
Predicted MW | 18.2 kDa |
Protein Sequence |
>RC200634 representing NM_004322
Red=Cloning site Green=Tags(s) MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIR SRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQ MRQSSSWTRVFQSWWDRNLGRGSSAPSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004313 |
RefSeq Size | 1127 |
RefSeq ORF | 504 |
Synonyms | BBC2; BCL2L8 |
Locus ID | 572 |
Cytogenetics | 11q13.1 |
Summary | The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL (B-cell lymphoma-extra large) and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq, Dec 2019] |
Protein Families | Druggable Genome |
Protein Pathways | Acute myeloid leukemia, Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Insulin signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403214 | BAD HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC418067 | BAD HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC429193 | BAD HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403214 | Transient overexpression lysate of BCL2-associated agonist of cell death (BAD), transcript variant 2 |
CN¥ 3,080.00 |
|
LY418067 | Transient overexpression lysate of BCL2-associated agonist of cell death (BAD), transcript variant 1 |
CN¥ 3,080.00 |
|
LY429193 | Transient overexpression lysate of BCL2-associated agonist of cell death (BAD), transcript variant 1 |
CN¥ 3,080.00 |
|
TP300634 | Recombinant protein of human BCL2-associated agonist of cell death (BAD), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP760222 | Recombinant protein of human BCL2-associated agonist of cell death (BAD), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |