FH (NM_000143) Human Mass Spec Standard
CAT#: PH300614
FH MS Standard C13 and N15-labeled recombinant protein (NP_000134)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | FH MS Standard C13 and N15-labeled recombinant protein (NP_000134) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200614 |
Predicted MW | 54.6 kDa |
Protein Sequence |
>RC200614 protein sequence
Red=Cloning site Green=Tags(s) MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAARMASQNSFRIEYDTFGELKVPNDKYYGA QTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVV WQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPG LQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVG TGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPR SGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSA RLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELG YLTAEQFDEWVKPKDMLGPK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000134 |
RefSeq Size | 1877 |
RefSeq ORF | 1530 |
Synonyms | FMRD; HLRCC; HsFH; LRCC; MCL; MCUL1 |
Locus ID | 2271 |
Cytogenetics | 1q43 |
Summary | The protein encoded by this gene is an enzymatic component of the tricarboxylic acid (TCA) cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Citrate cycle (TCA cycle), Metabolic pathways, Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400053 | FH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400053 | Transient overexpression lysate of fumarate hydratase (FH), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP300614 | Recombinant protein of human fumarate hydratase (FH), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |
|
TP720199 | Recombinant protein of human fumarate hydratase (FH), nuclear gene encoding mitochondrial protein |
CNY 3,140.00 |