SAPK4 (MAPK13) (NM_002754) Human Mass Spec Standard
CAT#: PH300606
MAPK13 MS Standard C13 and N15-labeled recombinant protein (NP_002745)
View other "SAPK4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MAPK13 MS Standard C13 and N15-labeled recombinant protein (NP_002745) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200606 |
Predicted MW | 42.1 kDa |
Protein Sequence |
>RC200606 protein sequence
Red=Cloning site Green=Tags(s) MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAY RELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKY IHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVG CIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQ AADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFS PIARKDSRRRSGMKL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002745 |
RefSeq Size | 6348 |
RefSeq ORF | 1095 |
Synonyms | MAPK-13; MAPK 13; p38delta; PRKM13; SAPK4 |
Locus ID | 5603 |
Cytogenetics | 6p21.31 |
Summary | This gene encodes a member of the mitogen-activated protein (MAP) kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The encoded protein is a p38 MAP kinase and is activated by proinflammatory cytokines and cellular stress. Substrates of the encoded protein include the transcription factor ATF2 and the microtubule dynamics regulator stathmin. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400973 | MAPK13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400973 | Transient overexpression lysate of mitogen-activated protein kinase 13 (MAPK13) |
CNY 3,080.00 |
|
TP300606 | Recombinant protein of human mitogen-activated protein kinase 13 (MAPK13), 20 µg |
CNY 2,900.00 |