GDI2 (NM_001494) Human Mass Spec Standard
CAT#: PH300596
GDI2 MS Standard C13 and N15-labeled recombinant protein (NP_001485)
View other "GDI2" proteins (5)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | GDI2 MS Standard C13 and N15-labeled recombinant protein (NP_001485) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200596 |
Predicted MW | 50.7 kDa |
Protein Sequence |
>RC200596 protein sequence
Red=Cloning site Green=Tags(s) MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGR DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRF RKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIK LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQL ICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYI AIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI YKRMTGSEFDFEEMKRKKNDIYGED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001485 |
RefSeq Size | 2441 |
RefSeq ORF | 1335 |
Synonyms | HEL-S-46e; RABGDIB |
Locus ID | 2665 |
Cytogenetics | 10p15.1 |
Summary | GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Adipose tissue depot‐specific intracellular and extracellular cues contributing to insulin resistance in obese individuals
,null,
The FASEB Journal
,PubMed ID 32293066
[GDI2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400572 | GDI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426526 | GDI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400572 | Transient overexpression lysate of GDP dissociation inhibitor 2 (GDI2), transcript variant 1 |
CN¥ 3,080.00 |
|
LY426526 | Transient overexpression lysate of GDP dissociation inhibitor 2 (GDI2), transcript variant 2 |
CN¥ 3,080.00 |
|
TP300596 | Recombinant protein of human GDP dissociation inhibitor 2 (GDI2), transcript variant 1, 20 µg |
CN¥ 2,900.00 |