ID3 (NM_002167) Human Mass Spec Standard
CAT#: PH300583
ID3 MS Standard C13 and N15-labeled recombinant protein (NP_002158)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ID3 MS Standard C13 and N15-labeled recombinant protein (NP_002158) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200583 |
Predicted MW | 13 kDa |
Protein Sequence |
>RC200583 protein sequence
Red=Cloning site Green=Tags(s) MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002158 |
RefSeq Size | 1252 |
RefSeq ORF | 357 |
Synonyms | bHLHb25; HEIR-1 |
Locus ID | 3399 |
Cytogenetics | 1p36.12 |
Summary | The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways | TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419492 | ID3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419492 | Transient overexpression lysate of inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3) |
CN¥ 3,080.00 |
|
TP300583 | Recombinant protein of human inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3), 20 µg |
CN¥ 2,900.00 |