H2AZ2 (NM_012412) Human Mass Spec Standard
CAT#: PH300564
H2AFV MS Standard C13 and N15-labeled recombinant protein (NP_036544)
View other "H2AZ2" proteins (6)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | H2AFV MS Standard C13 and N15-labeled recombinant protein (NP_036544) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200564 |
Predicted MW | 13.5 kDa |
Protein Sequence |
>RC200564 protein sequence
Red=Cloning site Green=Tags(s) MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELA GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036544 |
RefSeq Size | 1429 |
RefSeq ORF | 384 |
Synonyms | H2A.Z-2; H2AFV; H2AV |
Locus ID | 94239 |
Cytogenetics | 7p13 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402207 | H2AFV HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC408460 | H2AFV HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402207 | Transient overexpression lysate of H2A histone family, member V (H2AFV), transcript variant 1 |
CN¥ 3,080.00 |
|
LY408460 | Transient overexpression lysate of H2A histone family, member V (H2AFV), transcript variant 2 |
CN¥ 3,080.00 |
|
TP300564 | Recombinant protein of human H2A histone family, member V (H2AFV), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP762602 | Purified recombinant protein of Human H2A histone family, member V (H2AFV), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug |
CN¥ 2,480.00 |