Actin Regulatory Protein CAPG (CAPG) (NM_001747) Human Mass Spec Standard
CAT#: PH300497
CAPG MS Standard C13 and N15-labeled recombinant protein (NP_001738)
View other "Actin Regulatory Protein CAPG" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | CAPG MS Standard C13 and N15-labeled recombinant protein (NP_001738) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200497 |
Predicted MW | 38.5 kDa |
Protein Sequence |
>RC200497 protein sequence
Red=Cloning site Green=Tags(s) MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSHLHLWIGQQSS RDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGGVESAFHKTSTGAPAAIKKLY QVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGGKSNILERNKARDLALAIRDSERQGKAQVEI VTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISD DCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGRESPIFKQFFKDWK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001738 |
RefSeq Size | 1604 |
RefSeq ORF | 1044 |
Synonyms | AFCP; HEL-S-66; MCP |
Locus ID | 822 |
Cytogenetics | 2p11.2 |
Summary | This gene encodes a member of the gelsolin/villin family of actin-regulatory proteins. The encoded protein reversibly blocks the barbed ends of F-actin filaments in a Ca2+ and phosphoinositide-regulated manner, but does not sever preformed actin filaments. By capping the barbed ends of actin filaments, the encoded protein contributes to the control of actin-based motility in non-muscle cells. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2012] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Nanobodies targeting cortactin proline rich, helical and actin binding regions downregulate invadopodium formation and matrix degradation in SCC-61 cancer cells.
,null,
Biomedicine pharmacotherapy = Biomedecine pharmacotherapie
,PubMed ID 29567535
[CAPG]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419770 | CAPG HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419770 | Transient overexpression lysate of capping protein (actin filament), gelsolin-like (CAPG) |
CN¥ 3,080.00 |
|
TP300497 | Recombinant protein of human capping protein (actin filament), gelsolin-like (CAPG), 20 µg |
CN¥ 2,900.00 |
其它Actin Regulatory Protein CAPG产品