CKS2 (NM_001827) Human Mass Spec Standard
CAT#: PH300491
CKS2 MS Standard C13 and N15-labeled recombinant protein (NP_001818)
View other "CKS2" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | CKS2 MS Standard C13 and N15-labeled recombinant protein (NP_001818) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200491 |
Predicted MW | 9.9 kDa |
Protein Sequence |
>RC200491 protein sequence
Red=Cloning site Green=Tags(s) MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR RPLPKDQQK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001818 |
RefSeq Size | 627 |
RefSeq ORF | 237 |
Synonyms | CKSHS2 |
Locus ID | 1164 |
Cytogenetics | 9q22.2 |
Summary | CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419728 | CKS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419728 | Transient overexpression lysate of CDC28 protein kinase regulatory subunit 2 (CKS2) |
CN¥ 3,080.00 |
|
TP300491 | Recombinant protein of human CDC28 protein kinase regulatory subunit 2 (CKS2), 20 µg |
CN¥ 2,900.00 |