PTP4A1 (NM_003463) Human Mass Spec Standard
CAT#: PH300435
PTP4A1 MS Standard C13 and N15-labeled recombinant protein (NP_003454)
View other "PTP4A1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PTP4A1 MS Standard C13 and N15-labeled recombinant protein (NP_003454) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200435 |
Predicted MW | 19.8 kDa |
Protein Sequence |
>RC200435 protein sequence
Red=Cloning site Green=Tags(s) MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPF DDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGA FNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003454 |
RefSeq Size | 5093 |
RefSeq ORF | 519 |
Synonyms | HH72; PRL-1; PRL1; PTP(CAAX1); PTPCAAX1 |
Locus ID | 7803 |
Cytogenetics | 6q12 |
Summary | This gene encodes a member of a small class of prenylated protein tyrosine phosphatases (PTPs), which contain a PTP domain and a characteristic C-terminal prenylation motif. The encoded protein is a cell signaling molecule that plays regulatory roles in a variety of cellular processes, including cell proliferation and migration. The protein may also be involved in cancer development and metastasis. This tyrosine phosphatase is a nuclear protein, but may associate with plasma membrane by means of its prenylation motif. Pseudogenes related to this gene are located on chromosomes 1, 2, 5, 7, 11 and X. [provided by RefSeq, Jun 2013] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418665 | PTP4A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418665 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 1 (PTP4A1) |
CNY 3,080.00 |
|
TP300435 | Recombinant protein of human protein tyrosine phosphatase type IVA, member 1 (PTP4A1), 20 µg |
CNY 2,900.00 |