VAMP8 (NM_003761) Human Mass Spec Standard
CAT#: PH300405
VAMP8 MS Standard C13 and N15-labeled recombinant protein (NP_003752)
View other "VAMP8" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | VAMP8 MS Standard C13 and N15-labeled recombinant protein (NP_003752) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200405 |
Predicted MW | 11.4 kDa |
Protein Sequence |
>RC200405 protein sequence
Red=Cloning site Green=Tags(s) MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFW WKNVKMIVLICVIVFIIILFIVLFATGAFS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003752 |
RefSeq Size | 790 |
RefSeq ORF | 300 |
Synonyms | EDB; VAMP-8 |
Locus ID | 8673 |
Cytogenetics | 2p11.2 |
Summary | This gene encodes an integral membrane protein that belongs to the synaptobrevin/vesicle-associated membrane protein subfamily of soluble N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs). The encoded protein is involved in the fusion of synaptic vesicles with the presynaptic membrane.[provided by RefSeq, Jun 2010] |
Protein Families | Stem cell - Pluripotency, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401238 | VAMP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401238 | Transient overexpression lysate of vesicle-associated membrane protein 8 (endobrevin) (VAMP8) |
CNY 3,080.00 |
|
TP300405 | Recombinant protein of human vesicle-associated membrane protein 8 (endobrevin) (VAMP8), 20 µg |
CNY 2,900.00 |