SMAD1 (NM_001003688) Human Mass Spec Standard
CAT#: PH300299
SMAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001003688)
View other "SMAD1" proteins (6)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | SMAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001003688) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200299 |
Predicted MW | 52.3 kDa |
Protein Sequence |
>RC200299 protein sequence
Red=Cloning site Green=Tags(s) MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRS LDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLV PRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSS DPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELN NRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSD SSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001003688 |
RefSeq Size | 2880 |
RefSeq ORF | 1395 |
Synonyms | BSP-1; BSP1; JV4-1; JV41; MADH1; MADR1 |
Locus ID | 4086 |
Cytogenetics | 4q31.21 |
Summary | The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors |
Protein Pathways | TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416996 | SMAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC424106 | SMAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY416996 | Transient overexpression lysate of SMAD family member 1 (SMAD1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY424106 | Transient overexpression lysate of SMAD family member 1 (SMAD1), transcript variant 2 |
CN¥ 3,080.00 |
|
TP300299 | Recombinant protein of human SMAD family member 1 (SMAD1), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP760445 | Purified recombinant protein of Human SMAD family member 1 (SMAD1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |