LSM1 (NM_014462) Human Mass Spec Standard
CAT#: PH300288
LSM1 MS Standard C13 and N15-labeled recombinant protein (NP_055277)
View other "LSM1" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | LSM1 MS Standard C13 and N15-labeled recombinant protein (NP_055277) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200288 |
Predicted MW | 15.2 kDa |
Protein Sequence |
>RC200288 protein sequence
Red=Cloning site Green=Tags(s) MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055277 |
RefSeq Size | 1161 |
RefSeq ORF | 399 |
Synonyms | CASM; YJL124C |
Locus ID | 27257 |
Cytogenetics | 8p11.23 |
Summary | This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Nov 2011] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415265 | LSM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY415265 | Transient overexpression lysate of LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) |
CN¥ 3,080.00 |
|
TP300288 | Recombinant protein of human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), 20 µg |
CN¥ 2,900.00 |
|
TP720235 | Recombinant protein of human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) |
CN¥ 1,800.00 |