United States
Germany
Japan
United Kingdom
China
PDCD10 (NM_007217) Human Mass Spec Standard
CAT＃: PH300235
PDCD10 MS Standard C13 and N15-labeled recombinant protein (NP_009148)
View other "PDCD10" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | PDCD10 MS Standard C13 and N15-labeled recombinant protein (NP_009148) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200235 |
| Predicted MW | 24.7 kDa |
| Protein Sequence |
>RC200235 protein sequence
Red=Cloning site Green=Tags(s) MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKK SVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKE LLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT VA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009148 |
| RefSeq Size | 1454 |
| RefSeq ORF | 636 |
| Synonyms | CCM3; TFAR15 |
| Locus ID | 11235 |
| Cytogenetics | 3q26.1 |
| Summary | This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407854 | PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407855 | PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416120 | PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407854 | Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 2 |
CNY 3,080.00 |
|
| LY407855 | Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 3 |
CNY 3,080.00 |
|
| LY416120 | Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 1 |
CNY 3,080.00 |
|
| TP300235 | Recombinant protein of human programmed cell death 10 (PDCD10), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP720886 | Purified recombinant protein of Human programmed cell death 10 (PDCD10), transcript variant 1 |
CNY 3,140.00 |
