Transglutaminase 2 (TGM2) (NM_198951) Human Mass Spec Standard
CAT#: PH300226
TGM2 MS Standard C13 and N15-labeled recombinant protein (NP_945189)
View other "Transglutaminase 2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
Product Data | |
Description | TGM2 MS Standard C13 and N15-labeled recombinant protein (NP_945189) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200226 |
Predicted MW | 61.5 kDa |
Protein Sequence |
>RC200226 representing NM_198951
Red=Cloning site Green=Tags(s) MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQE AGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFN AWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRD CSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVF AAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPG YEGWQALDPTPQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVGQSMNMGSDFD VFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSGKALCSWSIC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_945189 |
RefSeq Size | 1879 |
RefSeq ORF | 1644 |
Synonyms | G(h); hTG2; TG(C); TGC; tTG |
Locus ID | 7052 |
Cytogenetics | 20q11.23 |
Summary | Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. The protein encoded by this gene acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis. Finally, the encoded protein is the autoantigen implicated in celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Huntington's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401458 | TGM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC403699 | TGM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401458 | Transient overexpression lysate of transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) (TGM2), transcript variant 1 |
CNY 4,840.00 |
|
LY403699 | Transient overexpression lysate of transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) (TGM2), transcript variant 2 |
CNY 3,080.00 |
|
PH317353 | TGM2 MS Standard C13 and N15-labeled recombinant protein (NP_004604) |
CNY 19,520.00 |
|
TP300226 | Recombinant protein of human transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) (TGM2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP317353 | Recombinant protein of human transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) (TGM2), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Transglutaminase 2产品