Malignant T cell amplified sequence 1 (MCTS1) (NM_014060) Human Mass Spec Standard
CAT#: PH300224
MCTS1 MS Standard C13 and N15-labeled recombinant protein (NP_054779)
View other "Malignant T cell amplified sequence 1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MCTS1 MS Standard C13 and N15-labeled recombinant protein (NP_054779) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200224 |
Predicted MW | 20.6 kDa |
Protein Sequence |
>RC200224 protein sequence
Red=Cloning site Green=Tags(s) MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLF FRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQ HALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054779 |
RefSeq Size | 9805 |
RefSeq ORF | 543 |
Synonyms | MCT-1; MCT1 |
Locus ID | 28985 |
Cytogenetics | Xq24 |
Summary | Anti-oncogene that plays a role in cell cycle regulation; decreases cell doubling time and anchorage-dependent growth; shortens the duration of G1 transit time and G1/S transition. When constitutively expressed, increases CDK4 and CDK6 kinases activity and CCND1/cyclin D1 protein level, as well as G1 cyclin/CDK complex formation. Involved in translation initiation; promotes recruitment of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits. Plays a role as translation enhancer; recruits the density-regulated protein/DENR and binds to the cap complex of the 5'-terminus of mRNAs, subsequently altering the mRNA translation profile; up-regulates protein levels of BCL2L2, TFDP1, MRE11, CCND1 and E2F1, while mRNA levels remains constant. Hyperactivates DNA damage signaling pathway; increased gamma-irradiation-induced phosphorylation of histone H2AX, and induces damage foci formation. Increases the overall number of chromosomal abnormalities such as larger chromosomes formation and multiples chromosomal fusions when overexpressed in gamma-irradiated cells. May play a role in promoting lymphoid tumor development: lymphoid cell lines overexpressing MCTS1 exhibit increased growth rates and display increased protection against apoptosis. May contribute to the pathogenesis and progression of breast cancer via promotion of angiogenesis through the decline of inhibitory THBS1/thrombospondin-1, and inhibition of apoptosis. Involved in the process of proteasome degradation to down-regulate Tumor suppressor p53/TP53 in breast cancer cell; Positively regulates phosphorylation of MAPK1 and MAPK3. Involved in translation initiation; promotes aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415503 | MCTS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415503 | Transient overexpression lysate of malignant T cell amplified sequence 1 (MCTS1), transcript variant 1 |
CNY 3,080.00 |
|
TP300224 | Recombinant protein of human malignant T cell amplified sequence 1 (MCTS1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP761506 | Purified recombinant protein of Human malignant T cell amplified sequence 1 (MCTS1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Malignant T cell amplified sequence 1产品