CRABP2 (NM_001878) Human Mass Spec Standard
CAT#: PH300221
CRABP2 MS Standard C13 and N15-labeled recombinant protein (NP_001869)
View other "CRABP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CRABP2 MS Standard C13 and N15-labeled recombinant protein (NP_001869) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200221 |
Predicted MW | 15.7 kDa |
Protein Sequence |
>RC200221 protein sequence
Red=Cloning site Green=Tags(s) MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGE EFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001869 |
RefSeq Size | 1088 |
RefSeq ORF | 414 |
Synonyms | CRABP-II; RBP6 |
Locus ID | 1382 |
Cytogenetics | 1q23.1 |
Summary | This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419677 | CRABP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419677 | Transient overexpression lysate of cellular retinoic acid binding protein 2 (CRABP2) |
CNY 3,080.00 |
|
TP300221 | Recombinant protein of human cellular retinoic acid binding protein 2 (CRABP2), 20 µg |
CNY 2,900.00 |