RABL4 (IFT27) (NM_006860) Human Mass Spec Standard
CAT#: PH300215
RABL4 MS Standard C13 and N15-labeled recombinant protein (NP_006851)
View other "RABL4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RABL4 MS Standard C13 and N15-labeled recombinant protein (NP_006851) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200215 |
Predicted MW | 20.5 kDa |
Protein Sequence |
>RC200215 protein sequence
Red=Cloning site Green=Tags(s) MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006851 |
RefSeq Size | 1101 |
RefSeq ORF | 558 |
Synonyms | BBS19; FAP156; RABL4; RAYL |
Locus ID | 11020 |
Cytogenetics | 22q12.3 |
Summary | This gene encodes a GTP-binding protein that is a core component of the intraflagellar transport complex B. Characterization of the similar Chlamydomonas protein indicates a function in cell cycle control. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416367 | IFT27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416367 | Transient overexpression lysate of RAB, member of RAS oncogene family-like 4 (RABL4) |
CNY 3,080.00 |
|
TP300215 | Recombinant protein of human RAB, member of RAS oncogene family-like 4 (RABL4), 20 µg |
CNY 2,900.00 |