SIRT5 (NM_012241) Human Mass Spec Standard
CAT#: PH300189
SIRT5 MS Standard C13 and N15-labeled recombinant protein (NP_036373)
View other "SIRT5" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SIRT5 MS Standard C13 and N15-labeled recombinant protein (NP_036373) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200189 |
Predicted MW | 33.9 kDa |
Protein Sequence |
>RC200189 protein sequence
Red=Cloning site Green=Tags(s) MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTF RGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQ NIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEA GCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTP ATNRFRFHFQGPCGTTLPEALACHENETVS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036373 |
RefSeq Size | 4538 |
RefSeq ORF | 930 |
Synonyms | SIR2L5 |
Locus ID | 23408 |
Cytogenetics | 6p23 |
Summary | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410600 | SIRT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415885 | SIRT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434135 | SIRT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410600 | Transient overexpression lysate of sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) (SIRT5), transcript variant 2 |
CNY 3,080.00 |
|
LY415885 | Transient overexpression lysate of sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) (SIRT5), transcript variant 1 |
CNY 3,080.00 |
|
LY434135 | Transient overexpression lysate of sirtuin 5 (SIRT5), transcript variant 3 |
CNY 3,080.00 |
|
TP300189 | Recombinant protein of human sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) (SIRT5), transcript variant 1, 20 µg |
CNY 2,900.00 |