PNPO (NM_018129) Human Mass Spec Standard
CAT#: PH300133
PNPO MS Standard C13 and N15-labeled recombinant protein (NP_060599)
View other "PNPO" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PNPO MS Standard C13 and N15-labeled recombinant protein (NP_060599) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200133 |
Predicted MW | 30 kDa |
Protein Sequence |
>RC200133 protein sequence
Red=Cloning site Green=Tags(s) MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAV QCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQV RVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYV LYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060599 |
RefSeq Size | 3482 |
RefSeq ORF | 783 |
Synonyms | HEL-S-302; PDXPO |
Locus ID | 55163 |
Cytogenetics | 17q21.32 |
Summary | The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine. Mutations in this gene result in pyridoxamine 5'-phosphate oxidase (PNPO) deficiency, a form of neonatal epileptic encephalopathy. [provided by RefSeq, Oct 2008] |
Protein Pathways | Metabolic pathways, Vitamin B6 metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413282 | PNPO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413282 | Transient overexpression lysate of pyridoxamine 5'-phosphate oxidase (PNPO) |
CNY 3,080.00 |
|
TP300133 | Recombinant protein of human pyridoxamine 5'-phosphate oxidase (PNPO), 20 µg |
CNY 2,900.00 |