Apc11 (ANAPC11) (NM_001002244) Human Mass Spec Standard
CAT#: PH300097
ANAPC11 MS Standard C13 and N15-labeled recombinant protein (NP_001002244)
View other "Apc11" proteins (16)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ANAPC11 MS Standard C13 and N15-labeled recombinant protein (NP_001002244) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200097 |
Predicted MW | 20.6 kDa |
Protein Sequence |
>RC200097 protein sequence
Red=Cloning site Green=Tags(s) MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCPLHGESISRCLGWCPQPVPVLGGRAHPQVPINT ASPTPGQHTGSLMSREESSRSPDPTPPALDQETSSLLRCTSPWCLDHSCDLFGITDQVSADGPRACRQGA RRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGMEVQGVRPDLALAGGAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001002244 |
RefSeq Size | 1186 |
RefSeq ORF | 588 |
Synonyms | APC11; Apc11p; HSPC214 |
Locus ID | 51529 |
Cytogenetics | 17q25.3 |
Summary | Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413973 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC424181 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC424182 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC424183 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC424184 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC424185 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC424186 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY413973 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 2 |
CN¥ 3,080.00 |
|
LY424181 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1 |
CN¥ 3,080.00 |
|
LY424182 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 3 |
CN¥ 3,080.00 |
|
LY424183 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 4 |
CN¥ 3,080.00 |
|
LY424184 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 5 |
CN¥ 3,080.00 |
|
LY424185 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 6 |
CN¥ 3,080.00 |
|
LY424186 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 7 |
CN¥ 3,080.00 |
|
TP300097 | Recombinant protein of human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP760669 | Purified recombinant protein of Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |