CINP (NM_032630) Human Mass Spec Standard
CAT#: PH300085
CINP MS Standard C13 and N15-labeled recombinant protein (NP_116019)
View other "CINP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CINP MS Standard C13 and N15-labeled recombinant protein (NP_116019) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200085 |
Predicted MW | 24.3 kDa |
Protein Sequence |
>RC200085 protein sequence
Red=Cloning site Green=Tags(s) MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSS PASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTW PTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHR AL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116019 |
RefSeq Size | 996 |
RefSeq ORF | 636 |
Locus ID | 51550 |
Cytogenetics | 14q32.31 |
Summary | The protein encoded by this gene is reported to be a component of the DNA replication complex as well as a genome-maintenance protein. It may interact with proteins important for replication initiation and has been shown to bind chromatin at the G1 phase of the cell cycle and dissociate from chromatin with replication initiation. It may also serve to regulate checkpoint signaling as part of the DNA damage response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403179 | CINP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403179 | Transient overexpression lysate of cyclin-dependent kinase 2 interacting protein (CINP) |
CNY 3,080.00 |
|
TP300085 | Recombinant protein of human cyclin-dependent kinase 2-interacting protein (CINP), 20 µg |
CNY 2,900.00 |