United States
Germany
Japan
United Kingdom
China
NFYC (NM_014223) Human Mass Spec Standard
CAT＃: PH300060
NFYC MS Standard C13 and N15-labeled recombinant protein (NP_055038)
View other "NFYC" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | NFYC MS Standard C13 and N15-labeled recombinant protein (NP_055038) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200060 |
| Predicted MW | 37.2 kDa |
| Protein Sequence |
>RC200060 protein sequence
Red=Cloning site Green=Tags(s) MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFA KAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAE PVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQG QAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQT EVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055038 |
| RefSeq Size | 2105 |
| RefSeq ORF | 1005 |
| Synonyms | CBF-C; CBFC; H1TF2A; HAP5; HSM; NF-YC |
| Locus ID | 4802 |
| Cytogenetics | 1p34.2 |
| Summary | This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Antigen processing and presentation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402291 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428190 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428191 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428192 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428193 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402291 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 2 |
CNY 3,080.00 |
|
| LY428190 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 3 |
CNY 3,080.00 |
|
| LY428191 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 1 |
CNY 3,080.00 |
|
| LY428192 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 4 |
CNY 3,080.00 |
|
| LY428193 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 5 |
CNY 3,080.00 |
|
| PH326680 | NFYC MS Standard C13 and N15-labeled recombinant protein (NP_001136061) |
CNY 14,250.00 |
|
| TP300060 | Recombinant protein of human nuclear transcription factor Y, gamma (NFYC), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP326680 | Purified recombinant protein of Homo sapiens nuclear transcription factor Y, gamma (NFYC), transcript variant 4, 20 µg |
CNY 2,900.00 |
