GIT2 (NM_139201) Human Mass Spec Standard
CAT#: PH300045
GIT2 MS Standard C13 and N15-labeled recombinant protein (NP_631940)
View other "GIT2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GIT2 MS Standard C13 and N15-labeled recombinant protein (NP_631940) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200045 |
Predicted MW | 52.6 kDa |
Protein Sequence |
>RC200045 protein sequence
Red=Cloning site Green=Tags(s) MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTLLQMVETLYNN GANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLPCRDDDSVTAKDLSKQLHSS VRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQILQAELLAVYGADPGTQDSSGKTPVDYARQG GHHELAERLVEIQYELTDRLAFYLCGRKPDHKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEE LAMDMYDEVDRRETDAVWLATQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDIL SDAKRRQQGSSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDL SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLLGKDAN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_631940 |
RefSeq Size | 2357 |
RefSeq ORF | 1413 |
Synonyms | CAT-2; CAT2; PKL |
Locus ID | 9815 |
Cytogenetics | 12q24.11 |
Summary | This gene encodes a member of the GIT protein family, which interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. GIT proteins traffic between cytoplasmic complexes, focal adhesions, and the cell periphery, and interact with Pak interacting exchange factor beta (PIX) to form large oligomeric complexes that transiently recruit other proteins. GIT proteins regulate cytoskeletal dynamics and participate in receptor internalization and membrane trafficking. This gene has been shown to repress lamellipodial extension and focal adhesion turnover, and is thought to regulate cell motility. This gene undergoes extensive alternative splicing to generate multiple isoforms, but the full-length nature of some of these variants has not been determined. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding. [provided by RefSeq, Sep 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408350 | GIT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415041 | GIT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC427594 | GIT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY408350 | Transient overexpression lysate of G protein-coupled receptor kinase interacting ArfGAP 2 (GIT2), transcript variant 4 |
CNY 3,080.00 |
|
LY415041 | Transient overexpression lysate of G protein-coupled receptor kinase interacting ArfGAP 2 (GIT2), transcript variant 3 |
CNY 4,840.00 |
|
LY427594 | Transient overexpression lysate of G protein-coupled receptor kinase interacting ArfGAP 2 (GIT2), transcript variant 6 |
CNY 4,840.00 |
|
TP300045 | Recombinant protein of human G protein-coupled receptor kinase interacting ArfGAP 2 (GIT2), transcript variant 4, 20 µg |
CNY 2,900.00 |