TMX2 (NM_015959) Human Mass Spec Standard
CAT#: PH300032
TMX2 MS Standard C13 and N15-labeled recombinant protein (NP_057043)
View other "TMX2" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TMX2 MS Standard C13 and N15-labeled recombinant protein (NP_057043) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200032 |
Predicted MW | 34 kDa |
Protein Sequence |
>RC200032 protein sequence
Red=Cloning site Green=Tags(s) MAVLAPLIALVYSVPRLSRWLAQPYYLLSALLSAAFLLVRKLPPLCHGLPTQREDGNPCDFDWREVEILM FLSAIVMMKNRRSITVEQHIGNIFMFSKVANTILFFRLDIRMGLLYITLCIVFLMTCKPPLYMGPEYIKY FNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVST SPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPV ASTPTTVSDGENKKDK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057043 |
RefSeq Size | 1741 |
RefSeq ORF | 888 |
Synonyms | CGI-31; NEDMCMS; PDIA12; PIG26; TXNDC14 |
Locus ID | 51075 |
Cytogenetics | 11q12.1 |
Summary | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402476 | TMX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428471 | TMX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402476 | Transient overexpression lysate of thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1 |
CNY 3,080.00 |
|
LY428471 | Transient overexpression lysate of thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 2 |
CNY 3,080.00 |
|
TP300032 | Recombinant protein of human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP721162 | Purified recombinant protein of Human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1 |
CNY 3,140.00 |