United States
Germany
Japan
United Kingdom
China
Junctional Adhesion Molecule 1 (F11R) (NM_144504) Human Mass Spec Standard
CAT＃: PH300004
F11R MS Standard C13 and N15-labeled recombinant protein (NP_653087)
View other "Junctional Adhesion Molecule 1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | F11R MS Standard C13 and N15-labeled recombinant protein (NP_653087) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200004 |
| Predicted MW | 32.6 kDa |
| Protein Sequence |
>RC200004 protein sequence
Red=Cloning site Green=Tags(s) MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTT RLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIY SQPSARSEGEFKQTSSFLV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_653087 |
| RefSeq Size | 3794 |
| RefSeq ORF | 897 |
| Synonyms | JAM, KAT, JAM1, JAMA, JCAM, CD321, JAM-1, JAM-A, PAM-1 |
| Locus ID | 50848 |
| Cytogenetics | 1q23.3 |
| Summary | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5' alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), Epithelial cell signaling in Helicobacter pylori infection, Leukocyte transendothelial migration, Tight junction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403392 | F11R HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413796 | F11R HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429529 | F11R HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403392 | Transient overexpression lysate of F11 receptor (F11R), transcript variant 5 |
CNY 3,080.00 |
|
| LY413796 | Transient overexpression lysate of F11 receptor (F11R) |
CNY 3,080.00 |
|
| PH321478 | F11R MS Standard C13 and N15-labeled recombinant protein (NP_058642) |
CNY 19,520.00 |
|
| TP300004 | Recombinant protein of human F11 receptor (F11R), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP321478 | Recombinant protein of human F11 receptor (F11R), 20 µg |
CNY 2,900.00 |
|
| TP720393 | Recombinant protein of human F11 receptor (F11R) |
CNY 3,140.00 |
其它Junctional Adhesion Molecule 1产品
