Menin (MEN1) (NM_130799) Human Mutant ORF Clone

CAT#: RC403512

  • TrueORF®

MEN1 Mutant (E26X), Myc-DDK-tagged ORF clone of Homo sapiens multiple endocrine neoplasia I (MEN1), transcript variant 2 as transfection-ready DNA



Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

Specifications

Product Data
Product Name Menin (MEN1) (NM_130799) Human Mutant ORF Clone
Mutation Description E26X
Affected Codon# 26
Affected NT# 76
Nucleotide Mutation MEN1 Mutant (E26X), Myc-DDK-tagged ORF clone of Homo sapiens multiple endocrine neoplasia I (MEN1), transcript variant 2 as transfection-ready DNA
Effect Multiple endocrine neoplasia 1
Synonyms MEAI; SCG2
Vector pCMV6-Entry
Tag Myc-DDK
ACCN NM_130799
ORF Size 75 bp
Sequence Data
>RC403512 representing NM_130799
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTGAAGGCCGCCCAGAAGACGCTGTTCCCGCTGCGCTCCATCGACGACGTGGTGCGCCTGTTTG
CTGCC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC403512 representing NM_130799
Red=Cloning site Green=Tags(s)

MGLKAAQKTLFPLRSIDDVVRLFAA

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NP_570711
RefSeq Size 75 bp
RefSeq ORF 1833 bp
Locus ID 4221
Domains Menin
Protein Families Druggable Genome, Transcription Factors
MW 2.8 kDa
Gene Summary This gene encodes menin, a tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. Menin is a scaffold protein that functions in histone modification and epigenetic gene regulation. It is thought to regulate several pathways and processes by altering chromatin structure through the modification of histones. [provided by RefSeq, May 2019]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...