Epoxide hydrolase (EPHX1) (NM_000120) Human Mutant ORF Clone

CAT#: RC401074

  • TrueORF®

EPHX1 Mutant (W97X), Myc-DDK-tagged ORF clone of Homo sapiens epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 1 as transfection-ready DNA



Need custom modification / cloning service?
Get a free quote

CN¥ 3,990.00


货期*
3周

规格
    • 10 ug

Product images

Specifications

Product Data
Product Name Epoxide hydrolase (EPHX1) (NM_000120) Human Mutant ORF Clone
Mutation Description W97X
Affected Codon# 97
Affected NT# 290
Nucleotide Mutation EPHX1 Mutant (W97X), Myc-DDK-tagged ORF clone of Homo sapiens epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 1 as transfection-ready DNA
Effect Poenil proein defiieny
Synonyms EPHX; EPOX; HYL1; MEH
Vector pCMV6-Entry
Tag Myc-DDK
ACCN NM_000120
ORF Size 288 bp
Sequence Data
>RC401074 representing NM_000120
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCTAGAAATCCTCCTCACTTCAGTGCTGGGCTTTGCCATCTACTGGTTCATCTCCCGGGACAAAG
AGGAAACTTTGCCACTTGAAGATGGGTGGTGGGGGCCAGGCACGAGGTCCGCAGCCAGGGAGGACGACAG
CATCCGCCCTTTCAAGGTGGAAACGTCAGATGAGGAGATCCACGACTTACACCAGAGGATCGATAAGTTC
CGTTTCACCCCACCTTTGGAGGACAGCTGCTTCCACTATGGCTTCAACTCCAACTACCTGAAGAAAGTCA
TCTCCTAC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC401074 representing NM_000120
Red=Cloning site Green=Tags(s)

MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKF
RFTPPLEDSCFHYGFNSNYLKKVISY

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NP_000111
RefSeq Size 288 bp
RefSeq ORF 1368 bp
Locus ID 2052
Domains abhydrolase
Protein Families Druggable Genome, Protease
Protein Pathways Metabolism of xenobiotics by cytochrome P450
MW 10.6 kDa
Gene Summary Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...