p57 Kip2 (CDKN1C) (NM_000076) Human Mutant ORF Clone

CAT#: RC401065

  • TrueORF®

CDKN1C Mutant (Q47X), Myc-DDK-tagged ORF clone of Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1 as transfection-ready DNA



Need custom modification / cloning service?
Get a free quote

CN¥ 3,990.00


货期*
3周

规格
    • 10 ug

Product images

Specifications

Product Data
Product Name p57 Kip2 (CDKN1C) (NM_000076) Human Mutant ORF Clone
Mutation Description Q47X
Affected Codon# 47
Affected NT# 139
Nucleotide Mutation CDKN1C Mutant (Q47X), Myc-DDK-tagged ORF clone of Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1 as transfection-ready DNA
Effect Beckwith-Wiedemann syndrome
Synonyms BWCR; BWS; KIP2; p57; p57Kip2; WBS
Vector pCMV6-Entry
Tag Myc-DDK
ACCN NM_000076
ORF Size 138 bp
Sequence Data
>RC401065 representing NM_000076
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGACGCGTCCCTCCGCAGCACATCCACGATGGAGCGTCTTGTCGCCCGTGGGACCTTCCCAGTAC
TAGTGCGCACCAGCGCCTGCCGCAGCCTCTTCGGGCCGGTGGACCACGAGGAGCTGAGCCGCGAGCTG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC401065 representing NM_000076
Red=Cloning site Green=Tags(s)

MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSREL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene     
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NP_000067
RefSeq Size 138 bp
RefSeq ORF 951 bp
Locus ID 1028
Domains CDI
Protein Families Druggable Genome
Protein Pathways Cell cycle
MW 5.1 kDa
Gene Summary This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...