United States
Germany
Japan
United Kingdom
China
protein pr (NC_012532) Virus Tagged ORF Clone
CAT＃: VC102540
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for Protein pr [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227207.1
View other clones from "Virus" (13)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Type | Virus Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | ZIKV_gp1, ZIKV |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>The Viral ORF clone VC102540 represents NCBI reference of YP_009227207 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGAAATTACAAGAAGGGGTTCAGCATACTATATGTATCTCGATCGAAGTGACGCGGGAAAAGCCA TAAGTTTTGCAACTACACTCGGGGTAAATAAATGTCATGTTCAAATTATGGATCTTGGGCACATGTGTGA CGCGACAATGAGTTATGAATGTCCAATGCTTGATGAGGGCGTAGAGCCAGACGACGTGGATTGCTGGTGC AATACGACATCCACATGGGTTGTATACGGAACCTGTCATCACAAAAAGGGCGAGGCTAGAAGGAGTAGAA GA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102540 representing YP_009227207
Red=Cloning sites Green=Tags MAEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMSYECPMLDEGVEPDDVDCWC NTTSTWVVYGTCHHKKGEARRSRR myc-FLAG tag |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | NC_012532 |
| ORF Size | 282 bp |
| OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NC_012532.1, YP_009227207 |
| RefSeq ORF | 282 bp |
| MW | 10.6 kDa |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| VC102527 | Myc-DDK-tagged ORF clone of viral ORF for anchored capsid protein C [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227206.1 |
CNY 3,800.00 |
|
| VC102528 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein C [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227196.1 |
CNY 1,320.00 |
|
| VC102529 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein precursor M [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227197.1 |
CNY 2,640.00 |
|
| VC102530 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein E [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227198.1 |
CNY 5,968.00 |
|
| VC102531 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS1 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227199.1 |
CNY 5,488.00 |
|
| VC102532 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2A [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227200.1 |
CNY 2,640.00 |
|
| VC102533 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2B [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227201.1 |
CNY 1,320.00 |
|
| VC102534 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS3 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227202.1 |
CNY 5,064.00 |
|
| VC102535 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4A [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227203.1 |
CNY 1,920.00 |
|
| VC102536 | Myc-DDK-tagged ORF clone of viral ORF for Protein 2K [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227209.1 |
CNY 3,800.00 |
|
| VC102537 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4B [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227204.1 |
CNY 3,600.00 |
|
| VC102538 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS5 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227205.1 |
CNY 7,280.00 |
|
| VC102539 | Myc-DDK-tagged ORF clone of viral ORF for Membrane glycoprotein M [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227208.1 |
CNY 3,800.00 |
其它protein pr产品
