NS1 (NC_001781) Virus Tagged ORF Clone

CAT#: VC102094

  • TrueORF®

Myc-DDK-tagged ORF clone of viral ORF for non-structural protein 1 [Human respiratory syncytial virus], codon optimized for human cell expression, NP_056856



  View other clones from "Virus" (9)

Need custom modification / cloning service?
Get a free quote

CNY 1,800.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Type Virus Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC102094 represents NCBI reference of NP_056856 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTGCAACTCTCTGAGCATGATAAAAGTTCGGCTGCAGAACCTCTTCGACAATGATGAAGTCGCGC
TCCTGAAGATCACATGTTACACAGACAAGCTGATCCTCCTGACAAACGCCTTGGCCAAAGCTGCCATCCA
CACTATAAAGCTGAACGGGATTGTGTTTATACACGTGATCACCTCTTCTGAGGTGTGCCCTGATAATAAC
ATTGTTGTCAAATCCAATTTTACCACAATGCCCATACTCCAGAATGGGGGGTATATTTGGGAGCTGATCG
AATTGACTCATTGTAGCCAGCTCAACGGACTCATGGATGACAACTGTGAAATCAAGTTTAGTAAGCGCCT
GTCAGATTCTGTAATGACTAACTATATGAATCAGATTTCTGATCTCCTCGGACTGGATCTGAATTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC102094 representing NP_056856
Red=Cloning sites Green=Tags

MGCNSLSMIKVRLQNLFDNDEVALLKITCYTDKLILLTNALAKAAIHTIKLNGIVFIHVITSSEVCPDNN
IVVKSNFTTMPILQNGGYIWELIELTHCSQLNGLMDDNCEIKFSKRLSDSVMTNYMNQISDLLGLDLNS

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_001781
ORF Size 417 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NC_001781.1, NP_056856
RefSeq ORF 417 bp
Locus ID 1489818
MW 15.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...