E7 (NC_004500) Virus Tagged ORF Clone

CAT#: VC102029

  • TrueORF®

Myc-DDK-tagged ORF clone of viral ORF for E7 [Human papillomavirus type 92], codon optimized for human cell expression, NP_775306



  View other clones from "Virus" (5)

Need custom modification / cloning service?
Get a free quote

CNY 3,800.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Type Virus Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC102029 represents NCBI reference of NP_775306 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTGGCAAGCAGGCAACAATTCCAGATATAGTACTTGACCTCCAGGACTTGGTGCAACCTATCGATC
TGCACTGCGACGAGGATCTCTCTGAGAATCAAGAAGAGGAGCCTGCACCCCAGCGCATCGATTACAAGAT
CGTATCATCCTGCGGGGGCTGCGGCATTAAACTGCGGATCTTCGCTAGCTGCACACAGTTCGGTATTAGA
ACTCTCCAGGACCTGCTCCTCGAGGAAATTGCCCTGCTGTGTCCCGACTGCAAGAACGGGCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC102029 representing NP_775306
Red=Cloning sites Green=Tags

MIGKQATIPDIVLDLQDLVQPIDLHCDEDLSENQEEEPAPQRIDYKIVSSCGGCGIKLRIFASCTQFGIR
TLQDLLLEEIALLCPDCKNGR

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_004500
ORF Size 273 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NC_004500.1, NP_775306
RefSeq ORF 273 bp
Locus ID 956298
MW 10.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...