UL50 (NC_001806) Virus Tagged ORF Clone
CAT#: VC100839
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 1], codon optimized for human cell expression, NP_044653
View other clones from "Virus" (62)
Need custom modification / cloning service?
Get a free quote
CNY 4,470.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100839 represents NCBI reference of NP_044653 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCCAGTGGGGCAGCGGGGCTATTTTGGTGCAACCAGACTCACTTGGGAGAGGGTACGATGGCGACT GGCATACAGCTGTAGCCACAAGGGGGGGCGGAGTCGTTCAGTTGAACTTGGTGAACAGAAGGGCTGTGGC CTTCATGCCAAAGGTATCCGGTGATTCCGGGTGGGCTGTCGGCCGGGTGTCTCTGGACCTCAGAATGGCA ATGCCTGCTGACTTCTGCGCCATCATTCACGCCCCCGCACTTGCCTCCCCCGGACACCACGTGATCCTGG GTCTGATCGATAGTGGTTACCGAGGGACCGTTATGGCAGTAGTAGTCGCACCCAAACGCACACGGGAGTT CGCCCCCGGAACCCTGCGGGTGGACGTCACATTCCTCGATATCCTTGCCACACCTCCTGCCTTGACCGAA CCAATTAGCCTGAGGCAGTTCCCACAGCTGGCTCCCCCTCCTCCCACCGGGGCAGGTATAAGAGAAGATC CCTGGCTCGAAGGGGCTCTTGGTGCCCCTAGCGTGACAACTGCTCTTCCCGCCCGGAGAAGAGGCAGATC ACTGGTCTACGCTGGAGAACTTACCCCTGTGCAAACAGAGCATGGCGACGGTGTTCGCGAAGCGATAGCC TTTTTGCCTAAGAGGGAAGAGGACGCAGGGTTTGACATCGTAGTTCGGCGCCCAGTAACAGTCCCCGCCA ACGGGACTACCGTGGTACAGCCTAGCCTTAGAATGCTCCACGCAGATGCCGGGCCAGCAGCCTGCTACGT GCTGGGCAGGTCATCCCTTAACGCGCGAGGCTTGTTGGTAGTCCCCACCCGATGGTTGCCCGGTCACGTT TGCGCCTTCGTCGTGTACAATCTGACCGGCGTGCCTGTCACTCTTGAAGCTGGAGCAAAGGTGGCTCAGC TGCTCGTTGCTGGTGCGGATGCCCTCCCATGGATCCCCCCAGACAATTTTCATGGGACGAAGGCCTTGAG GAATTATCCTAGAGGGGTGCCAGACAGTACAGCCGAGCCCAGGAACCCACCCCTGCTCGTGTTTACTAAC GAATTTGACGCAGAGGCTCCACCCTCCGAGCGAGGTACCGGAGGTTTCGGAAGCACTGGGATT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100839 representing NP_044653
Red=Cloning sites Green=Tags MSQWGSGAILVQPDSLGRGYDGDWHTAVATRGGGVVQLNLVNRRAVAFMPKVSGDSGWAVGRVSLDLRMA MPADFCAIIHAPALASPGHHVILGLIDSGYRGTVMAVVVAPKRTREFAPGTLRVDVTFLDILATPPALTE PISLRQFPQLAPPPPTGAGIREDPWLEGALGAPSVTTALPARRRGRSLVYAGELTPVQTEHGDGVREAIA FLPKREEDAGFDIVVRRPVTVPANGTTVVQPSLRMLHADAGPAACYVLGRSSLNARGLLVVPTRWLPGHV CAFVVYNLTGVPVTLEAGAKVAQLLVAGADALPWIPPDNFHGTKALRNYPRGVPDSTAEPRNPPLLVFTN EFDAEAPPSERGTGGFGSTGI TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001806 |
ORF Size | 1113 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_001806.1, NP_044653 |
RefSeq ORF | 1113 bp |
Locus ID | 2703421 |
UniProt ID | P04413 |
MW | 39.1 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100788 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 1], codon optimized for human cell expression, NP_044602 |
CNY 3,840.00 |
|
VC100789 | Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 1], codon optimized for human cell expression, NP_044603 |
CNY 3,990.00 |
|
VC100790 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL3 [Human herpesvirus 1], codon optimized for human cell expression, NP_044604 |
CNY 3,800.00 |
|
VC100791 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL4 [Human herpesvirus 1], codon optimized for human cell expression, NP_044605 |
CNY 3,800.00 |
|
VC100792 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044606 |
CNY 7,104.00 |
|
VC100793 | Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044607 |
CNY 10,170.00 |
|
VC100794 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 1], codon optimized for human cell expression, NP_044608 |
CNY 3,800.00 |
|
VC100795 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044609 |
CNY 6,040.00 |
|
VC100796 | Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 1], codon optimized for human cell expression, NP_044610 |
CNY 12,920.00 |
|
VC100797 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 1], codon optimized for human cell expression, NP_044611 |
CNY 5,800.00 |
|
VC100798 | Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044612 |
CNY 3,800.00 |
|
VC100799 | Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 1], codon optimized for human cell expression, NP_044613 |
CNY 7,510.00 |
|
VC100800 | Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 1], codon optimized for human cell expression, NP_044614 |
CNY 5,784.00 |
|
VC100801 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 1], codon optimized for human cell expression, NP_044615 |
CNY 3,600.00 |
|
VC100802 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 1], codon optimized for human cell expression, NP_044616 |
CNY 11,020.00 |
|
VC100803 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 1], codon optimized for human cell expression, NP_044617 |
CNY 4,470.00 |
|
VC100805 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044619 |
CNY 3,800.00 |
|
VC100806 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044620 |
CNY 20,710.00 |
|
VC100807 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL20 [Human herpesvirus 1], codon optimized for human cell expression, NP_044621 |
CNY 3,800.00 |
|
VC100808 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL21 [Human herpesvirus 1], codon optimized for human cell expression, NP_044622 |
CNY 6,460.00 |
|
VC100809 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 1], codon optimized for human cell expression, NP_044623 |
CNY 12,730.00 |
|
VC100810 | Myc-DDK-tagged ORF clone of viral ORF for thymidine kinase [Human herpesvirus 1], codon optimized for human cell expression, NP_044624 |
CNY 4,024.00 |
|
VC100811 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 1], codon optimized for human cell expression, NP_044625 |
CNY 2,640.00 |
|
VC100812 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 1], codon optimized for human cell expression, NP_044626 |
CNY 7,030.00 |
|
VC100814 | Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044628 |
CNY 3,800.00 |
|
VC100815 | Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044629 |
CNY 13,680.00 |
|
VC100816 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044630 |
CNY 11,970.00 |
|
VC100817 | Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044631 |
CNY 9,160.00 |
|
VC100818 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044632. Note: ORF is codon optimized |
CNY 9,456.00 |
|
VC100819 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044633 |
CNY 3,800.00 |
|
VC100820 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 1], codon optimized for human cell expression, NP_044634 |
CNY 7,220.00 |
|
VC100821 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 1], codon optimized for human cell expression, NP_044635 |
CNY 3,800.00 |
|
VC100822 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044636 |
CNY 3,800.00 |
|
VC100823 | Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044637 |
CNY 3,800.00 |
|
VC100825 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 1], codon optimized for human cell expression, NP_044639 |
CNY 16,910.00 |
|
VC100826 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 1], codon optimized for human cell expression, NP_044640 |
CNY 5,700.00 |
|
VC100828 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044642 |
CNY 4,090.00 |
|
VC100829 | Myc-DDK-tagged ORF clone of viral ORF for tegument host shutoff protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044643 |
CNY 3,656.00 |
|
VC100830 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044644. Note: ORF is codon optimized |
CNY 3,656.00 |
|
VC100832 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein C [Human herpesvirus 1], codon optimized for human cell expression, NP_044646 |
CNY 6,180.00 |
|
VC100833 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL45 [Human herpesvirus 1], codon optimized for human cell expression, NP_044647 |
CNY 3,800.00 |
|
VC100834 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP11/12 [Human herpesvirus 1], codon optimized for human cell expression, NP_044648 |
CNY 10,830.00 |
|
VC100836 | Myc-DDK-tagged ORF clone of viral ORF for transactivating tegument protein VP16 [Human herpesvirus 1], codon optimized for human cell expression, NP_044650 |
CNY 3,656.00 |
|
VC100837 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP22 [Human herpesvirus 1], codon optimized for human cell expression, NP_044651 |
CNY 3,600.00 |
|
VC100838 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 1], codon optimized for human cell expression, NP_044652 |
CNY 3,800.00 |
|
VC100840 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 1], codon optimized for human cell expression, NP_044654 |
CNY 2,400.00 |
|
VC100841 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044655 |
CNY 8,104.00 |
|
VC100842 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein K [Human herpesvirus 1], codon optimized for human cell expression, NP_044656 |
CNY 4,090.00 |
|
VC100844 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL55 [Human herpesvirus 1], codon optimized for human cell expression, NP_044658 |
CNY 3,800.00 |
|
VC100845 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL56 [Human herpesvirus 1], codon optimized for human cell expression, NP_044659 |
CNY 3,800.00 |
|
VC100849 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein ICP22 [Human herpesvirus 1], codon optimized for human cell expression, NP_044663 |
CNY 5,130.00 |
|
VC100850 | Myc-DDK-tagged ORF clone of viral ORF for virion protein US2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044664 |
CNY 3,800.00 |
|
VC100851 | Myc-DDK-tagged ORF clone of viral ORF for serine/threonine protein kinase US3 [Human herpesvirus 1], codon optimized for human cell expression, NP_044665 |
CNY 5,488.00 |
|
VC100852 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein G [Human herpesvirus 1], codon optimized for human cell expression, NP_044666 |
CNY 3,800.00 |
|
VC100853 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein J [Human herpesvirus 1], codon optimized for human cell expression, NP_044667 |
CNY 3,800.00 |
|
VC100854 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein D [Human herpesvirus 1], codon optimized for human cell expression, NP_044668 |
CNY 4,660.00 |
|
VC100855 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein I [Human herpesvirus 1], codon optimized for human cell expression, NP_044669 |
CNY 4,660.00 |
|
VC100856 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein E [Human herpesvirus 1], codon optimized for human cell expression, NP_044670 |
CNY 6,650.00 |
|
VC100857 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US8A [Human herpesvirus 1], codon optimized for human cell expression, NP_044671 |
CNY 3,800.00 |
|
VC100858 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US9 [Human herpesvirus 1], codon optimized for human cell expression, NP_044672 |
CNY 3,800.00 |
|
VC100859 | Myc-DDK-tagged ORF clone of viral ORF for virion protein US10 [Human herpesvirus 1], codon optimized for human cell expression, NP_044673 |
CNY 3,800.00 |
|
VC100861 | Myc-DDK-tagged ORF clone of viral ORF for TAP transporter inhibitor ICP47 [Human herpesvirus 1], codon optimized for human cell expression, NP_044675 |
CNY 1,920.00 |