2B (NC_013115) Virus Tagged ORF Clone
CAT#: VC100685
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for 2B [Human enterovirus 107], codon optimized for human cell expression, YP_003104790
View other clones from "Virus" (9)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100685 represents NCBI reference of YP_003104790 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGTGTCAGGGACTATGTGGAGCAGCTCGGTAATGCCTTCGGATCCGGTTTTACCAACCAGATTTGCG AGCAGGTTAACTTGTTGAAAGAGAGCCTCGTCGGGCAGGACAGTATTCTTGAGAAGTCCCTGAAGGCCCT GGTCAAAATCATTTCCGCCCTGGTCATTGTCGTAAGAAACCACGACGATCTGATAACCGTGACGGCCACG TTGGCACTGATCGGATGTACAACAAGTCCATGGCGGTGGCTTAAGTATAAAGTCTCCCAGTACTATGGTA TCCCCATGGCTGAGCGCCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100685 representing YP_003104790
Red=Cloning sites Green=Tags MGVRDYVEQLGNAFGSGFTNQICEQVNLLKESLVGQDSILEKSLKALVKIISALVIVVRNHDDLITVTAT LALIGCTTSPWRWLKYKVSQYYGIPMAERQ TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_013115 |
ORF Size | 300 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_013115.1, YP_003104790 |
RefSeq ORF | 300 bp |
MW | 11.2 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100680 | Myc-DDK-tagged ORF clone of viral ORF for VP4 [Human enterovirus 107], codon optimized for human cell expression, YP_003104785 |
CNY 3,800.00 |
|
VC100681 | Myc-DDK-tagged ORF clone of viral ORF for VP2 [Human enterovirus 107], codon optimized for human cell expression, YP_003104786 |
CNY 3,800.00 |
|
VC100682 | Myc-DDK-tagged ORF clone of viral ORF for VP3 [Human enterovirus 107], codon optimized for human cell expression, YP_003104787 |
CNY 3,800.00 |
|
VC100683 | Myc-DDK-tagged ORF clone of viral ORF for VP1 [Human enterovirus 107], codon optimized for human cell expression, YP_003104788 |
CNY 3,800.00 |
|
VC100684 | Myc-DDK-tagged ORF clone of viral ORF for 2A [Human enterovirus 107], codon optimized for human cell expression, YP_003104789 |
CNY 3,800.00 |
|
VC100686 | Myc-DDK-tagged ORF clone of viral ORF for 2C [Human enterovirus 107], codon optimized for human cell expression, YP_003104791 |
CNY 3,800.00 |
|
VC100687 | Myc-DDK-tagged ORF clone of viral ORF for 3A [Human enterovirus 107], codon optimized for human cell expression, YP_003104792 |
CNY 3,800.00 |
|
VC100688 | Myc-DDK-tagged ORF clone of viral ORF for 3B [Human enterovirus 107], codon optimized for human cell expression, YP_003104793 |
CNY 3,800.00 |
|
VC100689 | Myc-DDK-tagged ORF clone of viral ORF for 3C [Human enterovirus 107], codon optimized for human cell expression, YP_003104794 |
CNY 3,800.00 |