HCoV-OC43 NS2 Gene Tagged ORF Clone

CAT#: VC100602

  • TrueORF®

Myc-DDK-tagged ORF clone for NS2 protein [Human coronavirus OC43], codon optimized for human cell expression, NP_937951



  View other clones from "HCoV-OC43" (7)

Need custom modification / cloning service?
Get a free quote

CNY 3,800.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Type Virus Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC100602 represents NCBI reference of NP_937951 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATATATGGAGACCCGAGAAGAAGTATCTCAGGTACATCAATGGGTTTAATGTCAGCGAACTGGAGG
ACGCTTGCTTCAAATTCAACTATCAGTTCCCCAAGGTGGGATACTGCCGCGTGCCAAGCCATGCATGGTG
TCGAAACCAAGGGAGATTCTGTGCAACTTTCACACTGTACGGCAAAAGTAAGCATTACGACAAATATTTC
GGGGTGATAAATGGATTTACAGCCTTTGCGAACACCGTAGAGGATGCAGTGAATAAGCTGGTCTTTCTGG
CAGTCGATTTCATCACCTGGCGGAGGCAGGAGCTCAACGTTTATGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC100602 representing NP_937951
Red=Cloning sites Green=Tags

MDIWRPEKKYLRYINGFNVSELEDACFKFNYQFPKVGYCRVPSHAWCRNQGRFCATFTLYGKSKHYDKYF
GVINGFTAFANTVEDAVNKLVFLAVDFITWRRQELNVYG

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_005147
ORF Size 327 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NC_005147.1, NP_937951
RefSeq ORF 327 bp
Locus ID 2648211
MW 12.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...