E4 (NC_010956) Virus Tagged ORF Clone
CAT#: VC100456
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf6/7 [Human adenovirus D], codon optimized for human cell expression, YP_001974469
View other clones from "Virus" (37)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100456 represents NCBI reference of YP_001974469 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCAGACCGAAATTCAGTCATCTAGCCTGCGCCATCATCCTTATCGCAGGGCGAGATTGCCGCGGTCCG ATGAGGAGACCCGAGCAAGCCTGACCGAGCAGCACCCCTTGTTGCCGGACTGTGATCACGCGGACTATCA TAACACCGTCACCCTGGATTGCGAAGCCCGCCTCGATGATTTTAGCGAAGATGGATTCATTTCCATAACC GATCCGCGCCTGGCCCGACAGGAGACGGTGTGGATCATCGACCCAAAGAGTAGCTCTCGCACCAATGAGA ACATCTCACTTTTTAAGGCTACCAGGGCAGAGCGCACAGTGTACACCGTGAAATGGGCCGGCGGCGGCCG GCTGACCACTCGGGCCGGCGTGAAAATAAACAAGGACACC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100456 representing YP_001974469
Red=Cloning sites Green=Tags MQTEIQSSSLRHHPYRRARLPRSDEETRASLTEQHPLLPDCDHADYHNTVTLDCEARLDDFSEDGFISIT DPRLARQETVWIIDPKSSSRTNENISLFKATRAERTVYTVKWAGGGRLTTRAGVKINKDT TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_010956 |
ORF Size | 390 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_010956.1, YP_001974469 |
RefSeq ORF | 390 bp |
Locus ID | 6386282 |
MW | 14.9 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100424 | Myc-DDK-tagged ORF clone of viral ORF for control protein E1A [Human adenovirus D], codon optimized for human cell expression, YP_001974422 |
CNY 3,800.00 |
|
VC100425 | Myc-DDK-tagged ORF clone of viral ORF for control protein E1B 19K [Human adenovirus D], codon optimized for human cell expression, YP_001974423 |
CNY 3,800.00 |
|
VC100426 | Myc-DDK-tagged ORF clone of viral ORF for control protein E1B 55K [Human adenovirus D], codon optimized for human cell expression, YP_001974446 |
CNY 5,990.00 |
|
VC100427 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein IX [Human adenovirus D], codon optimized for human cell expression, YP_001974424 |
CNY 3,800.00 |
|
VC100428 | Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein IVa2 [Human adenovirus D], codon optimized for human cell expression, YP_001974425 |
CNY 5,510.00 |
|
VC100429 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase [Human adenovirus D], codon optimized for human cell expression, YP_001974426 |
CNY 17,670.00 |
|
VC100430 | Myc-DDK-tagged ORF clone of viral ORF for protein 136K [Human adenovirus D], codon optimized for human cell expression, YP_001974467 |
CNY 3,800.00 |
|
VC100431 | Myc-DDK-tagged ORF clone of viral ORF for terminal protein precursor pTP [Human adenovirus D], codon optimized for human cell expression, YP_001974468 |
CNY 7,600.00 |
|
VC100432 | Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein 52K [Human adenovirus D], codon optimized for human cell expression, YP_001974448 |
CNY 4,470.00 |
|
VC100433 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pIIIa [Human adenovirus D], codon optimized for human cell expression, YP_001974449 |
CNY 6,750.00 |
|
VC100434 | Myc-DDK-tagged ORF clone of viral ORF for penton base [Human adenovirus D], codon optimized for human cell expression, YP_001974428 |
CNY 6,270.00 |
|
VC100435 | Myc-DDK-tagged ORF clone of viral ORF for core protein precursor pVII [Human adenovirus D], codon optimized for human cell expression, YP_001974450 |
CNY 3,800.00 |
|
VC100436 | Myc-DDK-tagged ORF clone of viral ORF for core protein V [Human adenovirus D], codon optimized for human cell expression, YP_001974451 |
CNY 3,990.00 |
|
VC100437 | Myc-DDK-tagged ORF clone of viral ORF for core protein precursor pX [Human adenovirus D], codon optimized for human cell expression, YP_001974452 |
CNY 3,800.00 |
|
VC100438 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pVI [Human adenovirus D], codon optimized for human cell expression, YP_001974429 |
CNY 3,800.00 |
|
VC100439 | Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus D], codon optimized for human cell expression, YP_001974453 |
CNY 14,160.00 |
|
VC100440 | Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus D], codon optimized for human cell expression, YP_001974454 |
CNY 3,800.00 |
|
VC100441 | Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human adenovirus D], codon optimized for human cell expression, YP_001974427 |
CNY 5,990.00 |
|
VC100442 | Myc-DDK-tagged ORF clone of viral ORF for hexon assembly protein 100K [Human adenovirus D], codon optimized for human cell expression, YP_001974431 |
CNY 11,020.00 |
|
VC100443 | Myc-DDK-tagged ORF clone of viral ORF for protein 33K [Human adenovirus D], codon optimized for human cell expression, YP_001974455 |
CNY 3,800.00 |
|
VC100444 | Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein 22K [Human adenovirus D], codon optimized for human cell expression, YP_001974456 |
CNY 3,800.00 |
|
VC100445 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pVIII [Human adenovirus D], codon optimized for human cell expression, YP_001974457 |
CNY 3,800.00 |
|
VC100446 | Myc-DDK-tagged ORF clone of viral ORF for control protein E3 125K [Human adenovirus D], codon optimized for human cell expression, YP_001974432 |
CNY 3,800.00 |
|
VC100447 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-alpha [Human adenovirus D], codon optimized for human cell expression, YP_001974458 |
CNY 3,800.00 |
|
VC100448 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 gp19K [Human adenovirus D], codon optimized for human cell expression, YP_001974459 |
CNY 3,800.00 |
|
VC100449 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-beta [Human adenovirus D], codon optimized for human cell expression, YP_001974460 |
CNY 4,940.00 |
|
VC100450 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-gamma [Human adenovirus D], codon optimized for human cell expression, YP_001974461 |
CNY 3,800.00 |
|
VC100451 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein E3 RID-alpha [Human adenovirus D], codon optimized for human cell expression, YP_001974462 |
CNY 3,800.00 |
|
VC100452 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein E3 RID-beta [Human adenovirus D], codon optimized for human cell expression, YP_001974463 |
CNY 3,800.00 |
|
VC100453 | Myc-DDK-tagged ORF clone of viral ORF for control protein E3 147K [Human adenovirus D], codon optimized for human cell expression, YP_001974464 |
CNY 3,800.00 |
|
VC100454 | Myc-DDK-tagged ORF clone of viral ORF for protein U, partial [Human adenovirus D], codon optimized for human cell expression, YP_001974433 |
CNY 3,800.00 |
|
VC100455 | Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus D], codon optimized for human cell expression, YP_001974434 |
CNY 4,280.00 |
|
VC100457 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4 34K [Human adenovirus D], codon optimized for human cell expression, YP_001974470 |
CNY 3,800.00 |
|
VC100458 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf4 [Human adenovirus D], codon optimized for human cell expression, YP_001974471 |
CNY 3,800.00 |
|
VC100459 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf3 [Human adenovirus D], codon optimized for human cell expression, YP_001974472 |
CNY 3,800.00 |
|
VC100460 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf2 [Human adenovirus D], codon optimized for human cell expression, YP_001974473 |
CNY 3,800.00 |
|
VC100461 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf1 [Human adenovirus D], codon optimized for human cell expression, YP_001974474 |
CNY 3,800.00 |