Fxyd2 (NM_145717) Rat Tagged ORF Clone
CAT#: RR200370
- TrueORF®
Fxyd2 (Myc-DDK-tagged ORF) - Rat FXYD domain-containing ion transport regulator 2 (Fxyd2), transcript variant a, (10 ug)
"NM_145717" in other vectors (3)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Rat Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ATP1C; Atp1g1; GNAKATP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RR200370 representing NM_145717
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACAGAGCTGTCAGCTAACCATGGTGGCAGTGCCAAGGGGACGGAGAATCCCTTCGAGTATGACTATG AAACCGTCCGCAAAGGAGGCCTGATCTTCGCGGGCCTTGCCTTCGTCGTGGGACTCCTCATTCTCCTCAG CAAAAGATTCCGCTGTGGGGGCAGTAAGAAGCATAGGCAGGTCAATGAAGATGAGCTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RR200370 representing NM_145717
Red=Cloning site Green=Tags(s) MTELSANHGGSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLILLSKRFRCGGSKKHRQVNEDEL myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_145717 |
ORF Size | 198 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_145717.1, NP_663769.1 |
RefSeq Size | 239 bp |
RefSeq ORF | 201 bp |
Locus ID | 29639 |
UniProt ID | Q04679 |
MW | 7.3 kDa |
Gene Summary | This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. This gene, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. Related gene family members have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members, with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The Type III integral membrane protein encoded by this gene is the gamma subunit of the Na,K-ATPase present on the plasma membrane. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, it is thought that the gamma subunit modulates the enzyme's activity by inducing ion channel activity. Two transcript variants have been described for this gene that encode distinct isoforms. [provided by RefSeq, Jan 2010] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RN200370 | Fxyd2 (untagged ORF) - Rat FXYD domain-containing ion transport regulator 2 (Fxyd2), transcript variant a, (10 ug) |
CNY 3,990.00 |
|
RR200370L3 | Lenti ORF clone of Fxyd2 (Myc-DDK-tagged ORF) - Rat FXYD domain-containing ion transport regulator 2 (Fxyd2), transcript variant a, (10 ug) |
CNY 6,080.00 |
|
RR200370L4 | Lenti ORF clone of Fxyd2 (mGFP-tagged ORF) - Rat FXYD domain-containing ion transport regulator 2 (Fxyd2), transcript variant a, (10 ug) |
CNY 6,650.00 |