MAP2K1IP1 (LAMTOR3) (NM_001243736) Human Tagged ORF Clone

CAT#: RG235748

  • TrueORF®

LAMTOR3 (tGFP-tagged) - Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 (LAMTOR3), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_001243736" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
2周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit Polyclonal antibody to MP1 (MAPK scaffold protein 1)
    • 100 ul

CNY 6,281.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms MAP2K1IP1; MAPBP; MAPKSP1; MP1; PRO0633; Ragulator3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG235748 representing NM_001243736.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGCGGATGACCTAAAGCGATTCTTGTATAAAAAGTTACCAAGTGTTGAAGGGCTCCATGCCATTGTT
GTGTCAGATAGAGATGGAGTACCTGTTATTAAAGAGCATGCTTTGCGACCTGGTTTCTTATCCACTTTT
GCCCTTGCAACAGACCAAGGAAGCAAACTTGGACTTTCCAAAAATAAAAGTATCATCTGTTACTATAAC
ACCTACCAGGTGGTTCAATTTAATCGTTTACCTTTGGTGGTGAGTTTCATAGCCAGCAGCAGTGCCAAT
ACAGGACTAATTGTCAGCCTAGAAAAGGAACTTGCTCCATTGTTTGAAGAACTGAGACAAGTTGTGGAA
GTTTCT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
>Peptide sequence encoded by RG235748
Blue=ORF Red=Cloning site Green=Tag(s)

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYN
TYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV

Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001243736
ORF Size 351 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reference Data
RefSeq NM_001243736.1, NP_001230665.1
RefSeq Size 4259 bp
RefSeq ORF 354 bp
Locus ID 8649
UniProt ID Q9UHA4
Protein Families Druggable Genome
Protein Pathways MAPK signaling pathway
MW 13.4 kDa
Gene Summary This gene encodes a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Studies of the orthologous gene in mouse indicate that it regulates late endosomal traffic and cell proliferation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 13. [provided by RefSeq, Aug 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...