FBXW7 (NM_001257069) Human Tagged ORF Clone

CAT#: RG233368

  • TrueORF®

FBXW7 (tGFP-tagged) - Homo sapiens F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase (FBXW7), transcript variant 4

ORF Plasmid: DDK tGFP



  "NM_001257069" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


FBXW7 mouse monoclonal antibody, clone OTI6F5 (formerly 6F5)
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms AGO; CDC4; FBW6; FBW7; FBX30; FBXO30; FBXW6; hAgo; hCdc4; SEL-10; SEL10
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG233368 representing NM_001257069
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCAGGAACTGCTCTCTGTGGGCAGCAAAAGACGACGAACTGGAGGCTCTCTGAGAGGTAACCCTT
CCTCAAGCCAGGTAGATGAAGAACAGATGAATCGTGTGGTAGAGGAGGAACAGCAACAGCAACTCAGACA
ACAAGAGGAGGAGCACACTGCAAGGAATGGTGAAGTTGTTGGAGTAGAACCTAGACCTGGAGGCCAAAAT
GATTCCCAGCAAGGACAGTTGGAAGAAAACAATAATAGATTTATTTCGGTAGATGAGGACTCCTCAGGAA
ACCAAGAAGAACAAGAGGAAGATGAAGAACATGCTGGTGAACAAGATGAGGAGGATGAGGAGGAGGAGGA
GATGGACCAGGAGAGTGACGATTTTGATCAGTCTGATGATAGTAGCAGAGAAGATGAACATACACATACT
AACAGTGTCACGAACTCCAGTAGTATTGTGGACCTGCCCGTTCACCAACTCTCCTCCCCATTCTATACAA
AAACAACAAAAGTGAGTATATTCAATATATTGTTAACC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG233368 representing NM_001257069
Red=Cloning site Green=Tags(s)

MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQN
DSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHT
NSVTNSSSIVDLPVHQLSSPFYTKTTKVSIFNILLT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001257069
ORF Size 528 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001257069.1, NP_001243998.1
RefSeq Size 989 bp
RefSeq ORF 531 bp
Locus ID 55294
Protein Families Druggable Genome, Transmembrane
Protein Pathways Ubiquitin mediated proteolysis
Gene Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene was previously referred to as FBX30, and belongs to the Fbws class; in addition to an F-box, this protein contains 7 tandem WD40 repeats. This protein binds directly to cyclin E and probably targets cyclin E for ubiquitin-mediated degradation. Mutations in this gene are detected in ovarian and breast cancer cell lines, implicating the gene's potential role in the pathogenesis of human cancers. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...