Glutaredoxin 1 (GLRX) (NM_001118890) Human Tagged ORF Clone

CAT#: RG225029

  • TrueORF®

GLRX (tGFP-tagged) - Human glutaredoxin (thioltransferase) (GLRX), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_001118890" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit Polyclonal Anti-GLRX Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms GRX; GRX1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG225029 representing NM_001118890
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCAAGAGTTTGTGAACTGCAAAATCCAGCCTGGGAAGGTGGTTGTGTTCATCAAGCCCACCTGCC
CGTACTGCAGGAGGGCCCAAGAGATCCTCAGTCAATTGCCCATCAAACAAGGGCTTCTGGAATTTGTCGA
TATCACAGCCACCAACCACACTAACGAGATTCAAGATTATTTGCAACAGCTCACGGGAGCAAGAACGGTG
CCTCGAGTCTTTATTGGTAAAGATTGTATAGGCGGATGCAGTGATCTAGTCTCTTTGCAACAGAGTGGGG
AACTGCTGACGCGGCTAAAGCAGATTGGAGCTCTGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG225029 representing NM_001118890
Red=Cloning site Green=Tags(s)

MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV
PRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001118890
ORF Size 318 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001118890.2
RefSeq Size 1093 bp
RefSeq ORF 321 bp
Locus ID 2745
UniProt ID P35754
Protein Families Druggable Genome
Gene Summary This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...