EIF4EBP3 (NM_003732) Human Tagged ORF Clone

CAT#: RG210053

  • TrueORF®

EIF4EBP3 (tGFP-tagged) - Human eukaryotic translation initiation factor 4E binding protein 3 (EIF4EBP3)

ORF Plasmid: DDK tGFP



  "NM_003732" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,800.00

CNY 4,370.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit Polyclonal EIF4EBP3 Antibody
    • 100 ug

CNY 5,302.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms 4E-BP3; 4EBP3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG210053 representing NM_003732
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAACGTCCACTAGCTGCCCGATTCCCGGGGGCCGGGACCAGCTGCCCGACTGCTACAGCACCACGC
CGGGGGGCACGCTATACGCCACTACCCCCGGAGGCACCAGGATCATCTACGACCGAAAGTTCCTGCTGGA
GTGCAAGAACTCACCCATTGCCCGGACACCCCCCTGCTGCCTCCCTCAGATTCCCGGGGTCACAACTCCT
CCAACAGCCCCTCTCTCCAAGCTGGAGGAGCTGAAGGAGCAGGAGACAGAGGAAGAGATACCCGATGACG
CACAATTTGAAATGGACATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG210053 representing NM_003732
Red=Cloning site Green=Tags(s)

MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTP
PTAPLSKLEELKEQETEEEIPDDAQFEMDI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003732
ORF Size 300 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003732.3
RefSeq Size 728 bp
RefSeq ORF 303 bp
Locus ID 8637
UniProt ID O60516
Gene Summary This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq, Oct 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...