EMP2 (NM_001424) Human Tagged ORF Clone

CAT#: RG201995

  • TrueORF®

EMP2 (tGFP-tagged) - Human epithelial membrane protein 2 (EMP2)

ORF Plasmid: DDK tGFP



  "NM_001424" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 4,000.00

CNY 4,370.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit Polyclonal Anti-EMP2 Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms XMP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG201995 representing NM_001424
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGTGCTTCTTGCTTTCATCATCGCCTTCCACATCACCTCTGCAGCCTTGCTGTTCATTGCCACCG
TCGACAATGCCTGGTGGGTAGGAGATGAGTTTTTTGCAGATGTCTGGAGAATATGTACCAACAACACGAA
TTGCACAGTCATCAATGACAGCTTTCAAGAGTACTCCACGCTGCAGGCGGTCCAGGCCACCATGATCCTC
TCCACCATTCTCTGCTGCATCGCCTTCTTCATCTTCGTGCTCCAGCTCTTCCGCCTGAAGCAGGGAGAGA
GGTTTGTCCTAACCTCCATCATCCAGCTAATGTCATGTCTGTGTGTCATGATTGCGGCCTCCATTTATAC
AGACAGGCGTGAAGACATTCACGACAAAAACGCGAAATTCTATCCCGTGACCAGAGAAGGCAGCTACGGC
TACTCCTACATCCTGGCGTGGGTGGCCTTCGCCTGCACCTTCATCAGCGGCATGATGTACCTGATACTGA
GGAAGCGCAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG201995 representing NM_001424
Red=Cloning site Green=Tags(s)

MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMIL
STILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYG
YSYILAWVAFACTFISGMMYLILRKRK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001424
ORF Size 501 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_001424.6
RefSeq Size 1484 bp
RefSeq ORF 504 bp
Locus ID 2013
UniProt ID P54851
Domains PMP22_Claudin
Protein Families Transmembrane
Gene Summary This gene encodes a tetraspan protein of the PMP22/EMP family. The encoded protein regulates cell membrane composition. It has been associated with various functions including endocytosis, cell signaling, cell proliferation, cell migration, cell adhesion, cell death, cholesterol homeostasis, urinary albumin excretion, and embryo implantation. It is known to negatively regulate caveolin-1, a scaffolding protein which is the main component of the caveolae plasma membrane invaginations found in most cell types. Through activation of PTK2 it positively regulates vascular endothelial growth factor A. It also modulates the function of specific integrin isomers in the plasma membrane. Up-regulation of this gene has been linked to cancer progression in multiple different tissues. Mutations in this gene have been associated with nephrotic syndrome type 10 (NPHS10). [provided by RefSeq, Mar 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...