TCEAL1 (NM_001006639) Human Tagged ORF Clone

CAT#: RG201528

  • TrueORF®

TCEAL1 (tGFP-tagged) - Human transcription elongation factor A (SII)-like 1 (TCEAL1), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_001006639" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


TCEAL1 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms p21; pp21; SIIR; WEX9
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG201528 representing NM_001006639
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAAACCACGCAAAGAAAATGAAGAAGAGCCGCAGAGCGCGCCCAAGACCGATGAGGAGAGGCCTC
CGGTGGAGCACTCTCCCGAAAAGCAGTCCCCCGAGGAGCAGTCTTCGGAGGAGCAGTCCTCGGAGGAGGA
GTTCTTTCCTGAGGAGCTCTTGCCTGAGCTCCTGCCTGAGATGCTCCTCTCGGAGGAGCGCCCTCCGCAG
GAGGGTCTTTCCAGGAAGGACCTGTTTGAGGGGCGCCCTCCCATGGAGCAGCCTCCTTGTGGAGTAGGAA
AACATAAGCTTGAAGAAGGAAGCTTTAAAGAAAGGTTGGCTCGTTCTCGCCCGCAATTTAGAGGGGACAT
ACATGGCAGAAATTTAAGCAATGAGGAGATGATACAGGCAGCAGATGAGCTAGAAGAGATGAAAAGAGTA
AGAAACAAACTGATGATAATGCACTGGAAGGCAAAACGGAGCCGTCCTTATCCTATT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG201528 representing NM_001006639
Red=Cloning site Green=Tags(s)

MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQ
EGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRV
RNKLMIMHWKAKRSRPYPI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001006639
ORF Size 477 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_001006639.2
RefSeq Size 1208 bp
RefSeq ORF 480 bp
Locus ID 9338
UniProt ID Q15170
Protein Families Transcription Factors
Gene Summary This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...