TXNL4A (NM_006701) Human Tagged ORF Clone

CAT#: RG200266

  • TrueORF®

TXNL4A (tGFP-tagged) - Human thioredoxin-like 4A (TXNL4A)

ORF Plasmid: DDK tGFP



  "NM_006701" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,800.00

CNY 4,370.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


TXNL4A Rabbit polyclonal Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms BMKS; DIB1; DIM1; SNRNP15; TXNL4; U5-15kD
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG200266 representing NM_006701
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTACATGCTCCCGCACCTGCACAACGGCTGGCAGGTGGACCAGGCCATCCTCTCGGAGGAGGACC
GCGTGGTCGTCATCCGCTTCGGCCACGACTGGGATCCTACGTGCATGAAGATGGACGAGGTCCTGTACAG
CATCGCCGAGAAGGTTAAAAATTTTGCAGTTATTTATCTTGTGGATATTACAGAAGTGCCTGACTTCAAC
AAAATGTATGAGTTATACGATCCATGTACTGTCATGTTTTTCTTCAGGAACAAGCACATCATGATTGACT
TGGGGACTGGCAACAACAACAAGATTAACTGGGCCATGGAGGACAAGCAGGAGATGGTGGACATCATCGA
GACGGTGTACCGCGGGGCCCGCAAAGGCCGCGGCCTGGTGGTGTCCCCCAAGGACTACTCCACCAAGTAC
CGCTAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200266 representing NM_006701
Red=Cloning site Green=Tags(s)

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFN
KMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKY
RY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006701
ORF Size 426 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006701.5
RefSeq Size 1415 bp
RefSeq ORF 429 bp
Locus ID 10907
UniProt ID P83876
Domains DIM1
Protein Families Druggable Genome
Protein Pathways Spliceosome
Gene Summary The protein encoded by this gene is a member of the U5 small ribonucleoprotein particle (snRNP), and is involved in pre-mRNA splicing. This protein contains a thioredoxin-like fold and it is expected to interact with multiple proteins. Protein-protein interactions have been observed with the polyglutamine tract-binding protein 1 (PQBP1). Mutations in both the coding region and promoter region of this gene have been associated with Burn-McKeown syndrome, which is a rare disorder characterized by craniofacial dysmorphisms, cardiac defects, hearing loss, and bilateral choanal atresia. A pseudogene of this gene is found on chromosome 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...