BID (NM_197967) Human Tagged ORF Clone
CAT#: RC221674
- TrueORF®
BID (Myc-DDK-tagged)-Human BH3 interacting domain death agonist (BID), transcript variant 3
ORF Plasmid: tGFP
"NM_197967" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 4,180.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | FP497 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC221674 representing NM_197967
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACCGTAGCATCCCTCCGGGCCTGGTGAACGGCCTGGCCCTGCAGCTCAGGAACACCAGCCGGTCGG AGGAGGACCGGAACAGGGACCTGGCCACTGCCCTGGAGCAGCTGCTGCAGGCCTACCCTAGAGACATGGA GAAGGAGAAGACCATGCTGGTGCTGGCCCTGCTGCTGGCCAAGAAGGTGGCCAGTCACACGCCGTCCTTG CTCCGTGATGTCTTTCACACAACAGTGAATTTTATTAACCAGAACCTACGCACCTACGTGAGGAGCTTAG CCAGAAATGGGATGGAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC221674 representing NM_197967
Red=Cloning site Green=Tags(s) MDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSL LRDVFHTTVNFINQNLRTYVRSLARNGMD myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_197967 |
ORF Size | 297 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_197967.2 |
RefSeq Size | 2144 bp |
RefSeq ORF | 300 bp |
Locus ID | 637 |
UniProt ID | P55957 |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Pathways in cancer, Viral myocarditis |
MW | 11.1 kDa |
Gene Summary | This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2, and thus regulate apoptosis. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Aug 2020] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC221674L1 | Lenti-ORF clone of BID (Myc-DDK-tagged)-Human BH3 interacting domain death agonist (BID), transcript variant 3 |
CNY 4,200.00 |
|
RC221674L2 | Lenti-ORF clone of BID (mGFP-tagged)-Human BH3 interacting domain death agonist (BID), transcript variant 3 |
CNY 5,890.00 |
|
RC221674L3 | Lenti-ORF clone of BID (Myc-DDK-tagged)-Human BH3 interacting domain death agonist (BID), transcript variant 3 |
CNY 5,890.00 |
|
RC221674L4 | Lenti-ORF clone of BID (mGFP-tagged)-Human BH3 interacting domain death agonist (BID), transcript variant 3 |
CNY 5,890.00 |
|
RG221674 | BID (tGFP-tagged) - Human BH3 interacting domain death agonist (BID), transcript variant 3 |
CNY 3,400.00 |
|
SC108979 | BID (untagged)-Human BH3 interacting domain death agonist (BID), transcript variant 3 |
CNY 1,800.00 |